Anti-ITGA6, IgG1, Clone: [CL6957], Mouse, Monoclonal

Product Overview

• Article Name: Anti-ITGA6, IgG1, Clone: [CL6957], Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB91450
• Supplier Catalog Number: AMAb91450
• Alternative Catalog Number: ATA-AMAB91450-100,ATA-AMAB91450-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CD49f, Pan-Cancer

Product Description

integrin subunit alpha 6

Additional Information

Anti-ITGA6

Product Properties

• Clonality: Monoclonal
• Concentration: 1
• Clone Designation: [CL6957]
• Isotype: IgG1
• NCBI: 3655
• UniProt: P23229
• Buffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSS
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: ITGA6
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000

Images

Immunohistochemistry analysis in human placenta and skeletal muscle tissues using AMAb91450 antibody. Corresponding ITGA6 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human placenta shows strong basement membrane positivity in trophoblastic cells.

Immunohistochemical staining of human uterine cervix shows weak to moderate basement membrane positivity in squamous epithelium.

Immunohistochemical staining of human prostate shows weak to moderate basement membrane positivity in glandular cells.

Immunohistochemical staining of human skeletal muscle shows no membranous positivity in striated muscle fibers as expected.

AMAb91450

AMAb91450

AMAb91450