Anti-ITGA2, IgG1, Clone: [CL7318], Mouse, Monoclonal

Product Overview

• Article Name: Anti-ITGA2, IgG1, Clone: [CL7318], Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB91469
• Supplier Catalog Number: AMAb91469
• Alternative Catalog Number: ATA-AMAB91469-100,ATA-AMAB91469-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CD49B, Pan-Cancer

Product Description

integrin subunit alpha 2

Additional Information

Anti-ITGA2

Product Properties

• Clonality: Monoclonal
• Concentration: 1
• Clone Designation: [CL7318]
• Isotype: IgG1
• NCBI: 3673
• UniProt: P17301
• Buffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: ALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPV
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: ITGA2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500, WB: 1 µg/ml

Images

Immunohistochemistry analysis in human skin and skeletal muscle tissues using AMAb91469 antibody. Corresponding ITGA2 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human skin shows strong membranous positivity in cells in basal layer of epidermis.

Immunohistochemical staining of human prostate shows moderate membranous positivity in glandular cells.

Immunohistochemical staining of human small intestine shows moderate to strong membranous positivity in glandular cells.

Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.

Western blot analysis in human cell line RT-4.

AMAb91469

AMAb91469

AMAb91469