Anti-PGR, IgG1, Clone: [CL8721], Mouse, Monoclonal
Catalog Number:
ATA-AMAB91529
- Images (4)
| Article Name: | Anti-PGR, IgG1, Clone: [CL8721], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB91529 |
| Supplier Catalog Number: | AMAb91529 |
| Alternative Catalog Number: | ATA-AMAB91529-100,ATA-AMAB91529-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | NR3C3, PR, Pan-Cancer |
| progesterone receptor |
| Clonality: | Monoclonal |
| Concentration: | 0.8 |
| Clone Designation: | [CL8721] |
| Isotype: | IgG1 |
| NCBI: | 5241 |
| UniProt: | P06401 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | LLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPL |
| Target: | PGR |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 2-10 µg/ml, IHC: 1:2500 - 1:5000 |
|
|
AMAb91529 |
|
|
|
|
|
AMAb91529 |
|
|
AMAb91529 |
Product Guarantee and Expert Support
