Anti-KRT20, IgG1, Clone: [CL9390], Mouse, Monoclonal
Catalog Number:
ATA-AMAB91564
| Article Name: |
Anti-KRT20, IgG1, Clone: [CL9390], Mouse, Monoclonal |
| Biozol Catalog Number: |
ATA-AMAB91564 |
| Supplier Catalog Number: |
AMAb91564 |
| Alternative Catalog Number: |
ATA-AMAB91564-100,ATA-AMAB91564-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Mouse |
| Category: |
Antikörper |
| Application: |
IHC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
CK20, K20, MGC35423, Pan-Cancer |
| Clonality: |
Monoclonal |
| Concentration: |
1 |
| Clone Designation: |
[CL9390] |
| Isotype: |
IgG1 |
| NCBI: |
54474 |
| UniProt: |
P35900 |
| Buffer: |
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Protein A purified |
| Sequence: |
MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNEKMAMQNLND |
| Target: |
KRT20 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
IHC: 1:50 - 1:200 |
![]()
|
AMAb91564 |
![]()
|
AMAb91564 |
![]()
|
AMAb91564 |
