Anti-KLK3, IgG2b, Clone: [CL9422], Mouse, Monoclonal
Catalog Number:
ATA-AMAB91569
- Images (4)
| Article Name: | Anti-KLK3, IgG2b, Clone: [CL9422], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB91569 |
| Supplier Catalog Number: | AMAb91569 |
| Alternative Catalog Number: | ATA-AMAB91569-100,ATA-AMAB91569-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | APS, PSA, Pan-Cancer |
| kallikrein related peptidase 3 |
| Clonality: | Monoclonal |
| Concentration: | 0.6 |
| Clone Designation: | [CL9422] |
| Isotype: | IgG2b |
| NCBI: | 354 |
| UniProt: | P07288 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | SHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCA |
| Target: | KLK3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:5000 - 1:10000, WB: 1 µg/ml |
|
|
AMAb91569 |
|
|
|
|
|
AMAb91569 |
|
|
AMAb91569 |
Product Guarantee and Expert Support
