Anti-CHEK2, IgG1, Clone: [CL9440], Mouse, Monoclonal
Catalog Number:
ATA-AMAB91570
- Images (5)
| Article Name: | Anti-CHEK2, IgG1, Clone: [CL9440], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB91570 |
| Supplier Catalog Number: | AMAb91570 |
| Alternative Catalog Number: | ATA-AMAB91570-100,ATA-AMAB91570-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | bA444G7, CDS1, CHK2, HuCds1, PP1425, RAD53, Pan-Cancer |
| checkpoint kinase 2 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL9440] |
| Isotype: | IgG1 |
| NCBI: | 11200 |
| UniProt: | O96017 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | TSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNG |
| Target: | CHEK2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 2-10 µg/ml, IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
AMAb91570 |
|
|
|
|
|
|
|
|
AMAb91570 |
|
|
AMAb91570 |
Product Guarantee and Expert Support
