Anti-CD163, IgG1, Clone: [CL10652], Mouse, Monoclonal
Catalog Number:
ATA-AMAB91646
- Images (4)
| Article Name: | Anti-CD163, IgG1, Clone: [CL10652], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB91646 |
| Supplier Catalog Number: | AMAb91646 |
| Alternative Catalog Number: | ATA-AMAB91646-100,ATA-AMAB91646-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | M130, MM130, SCARI1, Pan-Cancer |
| Cd163 molecule |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL10652] |
| Isotype: | IgG1 |
| NCBI: | 9332 |
| UniProt: | Q86VB7 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | ACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNEDAGVTCSD |
| Target: | CD163 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
AMAb91646 |
|
|
|
|
|
AMAb91646 |
|
|
AMAb91646 |
Product Guarantee and Expert Support
