PrEST Antigen MAP4K5 Antibody 100ul, Unconjugated
Catalog Number:
ATA-APREST80461
- Images (0)
| Article Name: | PrEST Antigen MAP4K5 Antibody 100ul, Unconjugated |
| Biozol Catalog Number: | ATA-APREST80461 |
| Supplier Catalog Number: | APrEST80461 |
| Alternative Catalog Number: | ATA-APREST80461-100 |
| Manufacturer: | Atlas Antibodies |
| Category: | Antikörper |
| Conjugation: | Unconjugated |
| Alternative Names: | GCKR, KHS, KHS1 |
| NCBI: | 11183 |
| Buffer: | PBS and 1M Urea, pH 7.4. |
| Sequence: | YPEDNFPDEEKASTIKHCPDSESRAPQILRRQSSPSCGPVAETSSIGNGDGISKLMSENTEGSAQAPQLPRKKDKRDFPKPA |
| Target: | MAP4K5 |
Product Guarantee and Expert Support
