PrEST Antigen RYK Antibody 100ul, Unconjugated
Catalog Number:
ATA-APREST87458
- Images (0)
| Article Name: | PrEST Antigen RYK Antibody 100ul, Unconjugated |
| Biozol Catalog Number: | ATA-APREST87458 |
| Supplier Catalog Number: | APrEST87458 |
| Alternative Catalog Number: | ATA-APREST87458-100 |
| Manufacturer: | Atlas Antibodies |
| Category: | Antikörper |
| Conjugation: | Unconjugated |
| Alternative Names: | D3S3195, JTK5, JTK5A, RYK1 |
| NCBI: | 6259 |
| Buffer: | PBS and 1M Urea, pH 7.4. |
| Sequence: | SMKRIELDDSISASSSSQGLSQPSTQTTQYLRADTPNNATPITSSLGYPTLRIEKNDLRSVTLLEAKGKVKDIAISRERITLKDVLQEGTFGRIFHGILIDEKDPNKEKQAFVKTVKDQASEIQVTMMLTESCKLRGLHHRNLLPITH |
| Target: | RYK |
Product Guarantee and Expert Support
