PrEST Antigen RHOC Antibody 100ul, Unconjugated
Catalog Number:
ATA-APREST87586
- Images (0)
| Article Name: | PrEST Antigen RHOC Antibody 100ul, Unconjugated |
| Biozol Catalog Number: | ATA-APREST87586 |
| Supplier Catalog Number: | APrEST87586 |
| Alternative Catalog Number: | ATA-APREST87586-100 |
| Manufacturer: | Atlas Antibodies |
| Category: | Antikörper |
| Conjugation: | Unconjugated |
| Alternative Names: | ARH9, ARHC, RhoC |
| NCBI: | 389 |
| Buffer: | PBS and 1M Urea, pH 7.4. |
| Sequence: | KDLRKAGTWRTGSVPLATLSAQPRPRRECGRCLRWPLGLASRSARTSVGGAVPFSEIPKAFPTC |
| Target: | RHOC |
Product Guarantee and Expert Support
