Anti-GAB2, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-GAB2, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA000271
• Supplier Catalog Number: HPA000271
• Alternative Catalog Number: ATA-HPA000271-25,ATA-HPA000271-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: KIAA0571

Product Description

GRB2-associated binding protein 2

Additional Information

Anti-GAB2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 9846
• UniProt: Q9UQC2
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQEYLYLHQCISRRAERSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFYSLPKPSRHNTEFRDST
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: GAB2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:20 - 1:50

Images

Immunohistochemistry analysis in human bone marrow and skeletal muscle tissues using HPA000271 antibody. Corresponding GAB2 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human testis shows strong cytoplasmic and membranous positivity in cells in seminiferous ducts.

Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Immunohistochemical staining of human endometrium shows weak cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.

HPA000271

HPA000271

HPA000271