Anti-ZNF185, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ZNF185, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA000400
• Supplier Catalog Number: HPA000400
• Alternative Catalog Number: ATA-HPA000400-25,ATA-HPA000400-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: ZNF185

Product Description

zinc finger protein 185 (LIM domain)

Additional Information

Anti-ZNF185

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 7739
• UniProt: O15231
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: PADPSTPEQQNSPSGSEQFVRRESCTSRVRSPSSCMVTVTVTATSEQPHIYIPAPASELDSSSTTKGILFVKEYVSEVSSGKPVSARYSNVSSIEDSFAMEKKPPCGST
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: ZNF185
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human epididymis and liver tissues using Anti-ZNF185 antibody. Corresponding ZNF185 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human epididymis, liver, lymph node and testis using Anti-ZNF185 antibody HPA000400 (A) shows similar protein distribution across tissues to independent antibody HPA016438 (B).

Immunohistochemical staining of human liver shows low expression as expected.

Immunohistochemical staining of human epididymis shows high expression.

Immunohistochemical staining of human lymph node using Anti-ZNF185 antibody HPA000400.

Immunohistochemical staining of human testis using Anti-ZNF185 antibody HPA000400.

HPA000400

HPA000400

HPA000400