Anti-ARHGAP12, Rabbit, Polyclonal
Catalog Number:
ATA-HPA000412
- Images (9)
| Article Name: | Anti-ARHGAP12, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA000412 |
| Supplier Catalog Number: | HPA000412 |
| Alternative Catalog Number: | ATA-HPA000412-25,ATA-HPA000412-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ10971, FLJ20737, FLJ21785 |
| Rho GTPase activating protein 12 |
| Anti-ARHGAP12 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 94134 |
| UniProt: | Q8IWW6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RGTQERTWKPPRWTRDASISKGDFQNPGDQELLSSEENYYSTSYSQSDSQCGSPPRGWSEELDERGHTLYTSDYTNEKWLKHVDDQGRQYYYSADGSRSEWELPKYSSQQQREIIKSRSLDRRLQEPIVLTKWRHSTIVLDTNDKESPTASKPCFPENESSPSSP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ARHGAP12 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human stomach and skeletal muscle tissues using Anti-ARHGAP12 antibody. Corresponding ARHGAP12 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human stomach shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Western blot analysis in human cell line CAPAN-2. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA000412 |
|
|
|
|
|
HPA000412 |
|
|
HPA000412 |
Product Guarantee and Expert Support
