Anti-KRT17, Rabbit, Polyclonal
Catalog Number:
ATA-HPA000452
- Images (9)
| Article Name: | Anti-KRT17, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA000452 |
| Supplier Catalog Number: | HPA000452 |
| Alternative Catalog Number: | ATA-HPA000452-25,ATA-HPA000452-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PCHC1 |
| keratin 17, type I |
| Anti-KRT17 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 3872 |
| UniProt: | Q04695 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ARDYSQYYRTIEELQNKILTATVDNILLQIDRLAADDFRTKFETEQALRLSVEADINGLRRVLDELTLARADLEMQIENLKEELAYLKKNHEEEMLRGQVGGEINVEMDAAPGVDLSRI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | KRT17 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line hTCEpi shows localization to intermediate filaments. |
|
|
Immunohistochemical staining of human skin shows distinct positivity in keratinocytes. |
|
|
Western blot analysis in human cell lines HeLa and PC-3 using Anti-KRT17 antibody. Corresponding KRT17 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA000452 |
|
|
|
|
|
|
|
|
HPA000452 |
|
|
HPA000452 |
Product Guarantee and Expert Support
