Anti-LGALS3BP, Rabbit, Polyclonal

Catalog Number: ATA-HPA000554
Article Name: Anti-LGALS3BP, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA000554
Supplier Catalog Number: HPA000554
Alternative Catalog Number: ATA-HPA000554-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: 90K, BTBD17B, CyCAP, gp90, M2BP, MAC-2-BP, TANGO10B
lectin, galactoside-binding, soluble, 3 binding protein
Anti-LGALS3BP
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 3959
UniProt: Q08380
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLAS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: LGALS3BP
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human fallopian tube shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in striated muscle fibers as expected.
Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-LGALS3BP antibody. Corresponding LGALS3BP RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
HPA000554
HPA000554
HPA000554