Anti-LGALS3BP, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-LGALS3BP, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA000554
• Supplier Catalog Number: HPA000554
• Alternative Catalog Number: ATA-HPA000554-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: 90K, BTBD17B, CyCAP, gp90, M2BP, MAC-2-BP, TANGO10B

Product Description

lectin, galactoside-binding, soluble, 3 binding protein

Additional Information

Anti-LGALS3BP

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 3959
• UniProt: Q08380
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: RHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLAS
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: LGALS3BP
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunohistochemical staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human fallopian tube shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in striated muscle fibers as expected.

Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-LGALS3BP antibody. Corresponding LGALS3BP RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

HPA000554

HPA000554

HPA000554