Anti-SRGN, Rabbit, Polyclonal
Catalog Number:
ATA-HPA000759
- Images (9)
| Article Name: | Anti-SRGN, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA000759 |
| Supplier Catalog Number: | HPA000759 |
| Alternative Catalog Number: | ATA-HPA000759-25,ATA-HPA000759-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PPG, PRG, PRG1 |
| serglycin |
| Anti-SRGN |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 5552 |
| UniProt: | P10124 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SRGN |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human bone marrow and liver tissues using Anti-SRGN antibody. Corresponding SRGN RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human bone marrow shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Western blot analysis in human cell lines A-549 and Caco-2 using Anti-SRGN antibody. Corresponding SRGN RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in human cell line HL-60. |
|
|
HPA000759 |
|
|
|
|
|
HPA000759 |
|
|
HPA000759 |
Product Guarantee and Expert Support
