Anti-ACOT4, Rabbit, Polyclonal
Catalog Number:
ATA-HPA000779
- Images (9)
| Article Name: | Anti-ACOT4, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA000779 |
| Supplier Catalog Number: | HPA000779 |
| Alternative Catalog Number: | ATA-HPA000779-25,ATA-HPA000779-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ31235, PTE-Ib, PTE2B |
| acyl-CoA thioesterase 4 |
| Anti-ACOT4 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 122970 |
| UniProt: | Q8N9L9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PPLGYDLRRIKVAFSGLVDIVDIRLVGGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAHGKEKPQIICYPGTGHYIEPPYFPLCPASLHRLLNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGGTQKT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ACOT4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity. |
|
|
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17 Lane 2: Human cell line RT-4 Lane 3: Human cell line EFO-21 |
|
|
HPA000779 |
|
|
|
|
|
HPA000779 |
|
|
HPA000779 |
Product Guarantee and Expert Support
