Anti-HIF1A, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-HIF1A, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA000907
• Supplier Catalog Number: HPA000907
• Alternative Catalog Number: ATA-HPA000907-25,ATA-HPA000907-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: bHLHe78, HIF-1alpha, HIF1, MOP1, PASD8, Pan-Cancer

Product Description

hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)

Additional Information

Anti-HIF1A

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 3091
• UniProt: Q16665
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: KSHPRSPNVLSVALSQRTTVPEEELNPKILALQQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVPIQGSRNLLQGEELLRALD
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: HIF1A
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml

Images

Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm & nuclear bodies.

HPA000907