Anti-NKAP, Rabbit, Polyclonal
Catalog Number:
ATA-HPA000916
- Images (9)
| Article Name: | Anti-NKAP, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA000916 |
| Supplier Catalog Number: | HPA000916 |
| Alternative Catalog Number: | ATA-HPA000916-25,ATA-HPA000916-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ22626 |
| NFKB activating protein |
| Anti-NKAP |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 79576 |
| UniProt: | Q8N5F7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RRRSSSKSPKPSKSARSPRGRRSRSHSCSRSGDRNGLTHQLGGLSQGSRNQSYRSRSRSRSRERPSAPRGIPFASASSSVYYGSYSRPYGSDKPWPSLLDKEREESLRQKRLS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NKAP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human tonsil shows nuclear positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows nuclear positivity in neurons. |
|
|
Immunohistochemical staining of human small intestine shows moderate nuclear positivity in glandular cells. |
|
|
HPA000916 |
|
|
|
|
|
HPA000916 |
|
|
HPA000916 |
Product Guarantee and Expert Support
