Anti-STAT1, Rabbit, Polyclonal
Catalog Number:
ATA-HPA000931
- Images (9)
| Article Name: | Anti-STAT1, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA000931 |
| Supplier Catalog Number: | HPA000931 |
| Alternative Catalog Number: | ATA-HPA000931-25,ATA-HPA000931-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ISGF-3, STAT91 |
| signal transducer and activator of transcription 1, 91kDa |
| Anti-STAT1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 6772 |
| UniProt: | P42224 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FQEDPIQMSMIIYSCLKEERKILEQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | STAT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human lymph node shows cytoplasmic positivity in non-germinal center cells. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and HEK293 using Anti-STAT1 antibody. Corresponding STAT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1. |
|
|
Western blot analysis using Anti-STAT1 antibody HPA000931 (A) shows similar pattern to independent antibody HPA000982 (B). |
|
|
HPA000931 |
|
|
|
|
|
|
|
|
HPA000931 |
|
|
HPA000931 |
Product Guarantee and Expert Support
