Anti-DTD2, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-DTD2, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA001117
• Supplier Catalog Number: HPA001117
• Alternative Catalog Number: ATA-HPA001117-25,ATA-HPA001117-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: C14orf126, MGC9912

Product Description

D-tyrosyl-tRNA deacylase 2 (putative)

Additional Information

Anti-DTD2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 112487
• UniProt: Q96FN9
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: WVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIFE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: DTD2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50

Images

Immunofluorescent staining of human cell line SiHa shows localization to vesicles.

Immunohistochemical staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Immunohistochemical staining of human testis shows moderatemcytoplasmic positivity in cells in seminiferous ducts.

HPA001117

HPA001117

HPA001117