Anti-YY1, Rabbit, Polyclonal
Catalog Number:
ATA-HPA001119
- Images (9)
| Article Name: | Anti-YY1, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA001119 |
| Supplier Catalog Number: | HPA001119 |
| Alternative Catalog Number: | ATA-HPA001119-25,ATA-HPA001119-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DELTA, INO80S, NF-E1, UCRBP, YIN-YANG-1 |
| YY1 transcription factor |
| Anti-YY1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 7528 |
| UniProt: | P25490 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | YY1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human lymph node shows strong nuclear positivity. |
|
|
Immunohistochemical staining of human small intestine shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas moderate nuclear positivity in exocrine glandular cells. |
|
|
Western blot analysis in human cell line HL-60. |
|
|
HPA001119 |
|
|
|
|
|
HPA001119 |
|
|
HPA001119 |
Product Guarantee and Expert Support
