Anti-COMT, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-COMT, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA001169
• Supplier Catalog Number: HPA001169
• Alternative Catalog Number: ATA-HPA001169-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: Pan-Cancer

Product Description

catechol-O-methyltransferase

Additional Information

Anti-COMT

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 1312
• UniProt: P21964
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: YCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIY
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: COMT
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Images

Immunohistochemistry analysis in human placenta and pancreas tissues using Anti-COMT antibody. Corresponding COMT RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human placenta shows high expression.

Immunohistochemical staining of human pancreas shows low expression as expected.

Western blot analysis in human cell lines MCF-7 and PC-3 using Anti-COMT antibody. Corresponding COMT RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

HPA001169