Anti-EGFR, Rabbit, Polyclonal
Catalog Number:
ATA-HPA001200
- Images (6)
| Article Name: | Anti-EGFR, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA001200 |
| Supplier Catalog Number: | HPA001200 |
| Alternative Catalog Number: | ATA-HPA001200-25,ATA-HPA001200-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ERBB, ERBB1, Pan-Cancer |
| epidermal growth factor receptor |
| Anti-EGFR |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 1956 |
| UniProt: | P00533 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EFKDSLSITNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIIS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | EGFR |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human placenta and pancreas tissues using HPA001200 antibody. Corresponding EGFR RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
HPA001200 |
|
|
HPA001200 |
|
|
HPA001200 |
Product Guarantee and Expert Support
