Anti-CBS, Rabbit, Polyclonal
Catalog Number:
ATA-HPA001223
- Images (9)
| Article Name: | Anti-CBS, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA001223 |
| Supplier Catalog Number: | HPA001223 |
| Alternative Catalog Number: | ATA-HPA001223-25,ATA-HPA001223-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HIP4 |
| cystathionine-beta-synthase |
| Anti-CBS |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 875 |
| UniProt: | P35520 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTRFDSPESHVGVAWRLKNEIPNSHILDQYRSNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIGAPHR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CBS |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & vesicles. |
|
|
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells. |
|
|
Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in a subset of cells in granular layer, as well as in neuropil of molecular layer. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected. |
|
|
HPA001223 |
|
|
|
|
|
HPA001223 |
|
|
HPA001223 |
Product Guarantee and Expert Support
