Anti-TRIB2, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-TRIB2, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA001305
• Supplier Catalog Number: HPA001305
• Alternative Catalog Number: ATA-HPA001305-25,ATA-HPA001305-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: GS3955, TRB2

Product Description

tribbles pseudokinase 2

Additional Information

Anti-TRIB2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 28951
• UniProt: Q92519
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: TIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLRE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: TRIB2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp and white pulp.

Western blot analysis in human cell line K562.

Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

HPA001305

HPA001305

HPA001305