Anti-STX4, Rabbit, Polyclonal

Catalog Number: ATA-HPA001330
Article Name: Anti-STX4, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA001330
Supplier Catalog Number: HPA001330
Alternative Catalog Number: ATA-HPA001330-25,ATA-HPA001330-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: p35-2, STX4A
syntaxin 4
Anti-STX4
Clonality: Polyclonal
Isotype: IgG
NCBI: 6810
UniProt: Q12846
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: STX4
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.
Immunohistochemical staining of human skin shows membranous positivity in epidermal cells.
Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-STX4 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Western blot analysis in human cell line MCF-7.
HPA001330
HPA001330
HPA001330