Anti-RAB27A, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-RAB27A, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA001333
• Supplier Catalog Number: HPA001333
• Alternative Catalog Number: ATA-HPA001333-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: GS2, HsT18676, RAB27, RAM

Product Description

RAB27A, member RAS oncogene family

Additional Information

Anti-RAB27A

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 5873
• UniProt: P51159
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLS
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: RAB27A
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunohistochemistry analysis in human stomach and skeletal muscle tissues using HPA001333 antibody. Corresponding RAB27A RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells with additional stron membranous positivity in a subset of glandular cells.

Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.

Western blot analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-RAB27A antibody. Corresponding RAB27A RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

HPA001333

HPA001333

HPA001333