Anti-ERBB2, Rabbit, Polyclonal
Catalog Number:
ATA-HPA001338
| Article Name: |
Anti-ERBB2, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ATA-HPA001338 |
| Supplier Catalog Number: |
HPA001338 |
| Alternative Catalog Number: |
ATA-HPA001338-25,ATA-HPA001338-100 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ICC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
CD340, HER-2, HER2, NEU, NGL, Pan-Cancer |
| erb-b2 receptor tyrosine kinase 2 |
| Clonality: |
Polyclonal |
| Concentration: |
0.05 mg/ml |
| Isotype: |
IgG |
| NCBI: |
2064 |
| UniProt: |
P04626 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
LVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDAEEYLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGAGSDVFDGDGAPHR |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
ERBB2 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
ICC-IF: 0.25-2 µg/ml |
![]()
|
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane. |
![]()
|
HPA001338 |
