Anti-CDH13, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CDH13, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA001380
• Supplier Catalog Number: HPA001380
• Alternative Catalog Number: ATA-HPA001380-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CDHH

Product Description

cadherin 13

Additional Information

Anti-CDH13

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 1012
• UniProt: P55290
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: GTGTLLITLEDVNDPFIYPTVAEVCDDAKNLSVVILGASDKDLHPNTDPFKFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQVCSCRNSKVDCAGALRFSLPSVLLLSLFSLA
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CDH13
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line SiHa shows localization to plasma membrane.

Immunohistochemistry analysis in human heart muscle and pancreas tissues using Anti-CDH13 antibody. Corresponding CDH13 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human heart muscle shows high expression.

Immunohistochemical staining of human pancreas shows low expression as expected.

Western blot analysis in human cell line U-138MG.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400505)

HPA001380

HPA001380