Anti-ERBB2 Antibody 100ul, Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA001383
Article Name: Anti-ERBB2 Antibody 100ul, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA001383
Supplier Catalog Number: HPA001383
Alternative Catalog Number: ATA-HPA001383-100,ATA-HPA001383-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CD340, HER-2, HER2, NEU, NGL
erb-b2 receptor tyrosine kinase 2
Anti-ERBB2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 2064
UniProt: P04626
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ERBB2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line MCF7 shows localization to plasma membrane.
Immunohistochemical staining of human breast cancer shows strong membranous positivity in tumor cells.
Immunohistochemical staining of human breast cancer shows no positivity in tumor cells as expected.
Western blot analysis in human cell line SK-BR-3.
HPA001383
HPA001383
HPA001383