Anti-ERBB2, Rabbit, Polyclonal
Catalog Number:
ATA-HPA001383
- Images (9)
| Article Name: | Anti-ERBB2, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA001383 |
| Supplier Catalog Number: | HPA001383 |
| Alternative Catalog Number: | ATA-HPA001383-25,ATA-HPA001383-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD340, HER-2, HER2, NEU, NGL, Pan-Cancer |
| erb-b2 receptor tyrosine kinase 2 |
| Anti-ERBB2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 2064 |
| UniProt: | P04626 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ERBB2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to plasma membrane. |
|
|
Immunohistochemical staining of human breast cancer shows strong membranous positivity in tumor cells. |
|
|
Immunohistochemical staining of human breast cancer shows no positivity in tumor cells as expected. |
|
|
Western blot analysis in human cell line SK-BR-3. |
|
|
HPA001383 |
|
|
|
|
|
|
|
|
HPA001383 |
|
|
HPA001383 |
Product Guarantee and Expert Support
