Anti-FLOT1, Rabbit, Polyclonal
Catalog Number:
ATA-HPA001393
- Images (9)
| Article Name: | Anti-FLOT1, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA001393 |
| Supplier Catalog Number: | HPA001393 |
| Alternative Catalog Number: | ATA-HPA001393-25,ATA-HPA001393-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLOT1 |
| flotillin 1 |
| Anti-FLOT1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 10211 |
| UniProt: | O75955 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FLOT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human adrenal gland and skin tissues using Anti-FLOT1 antibody. Corresponding FLOT1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human adrenal gland shows high expression. |
|
|
Immunohistochemical staining of human skin shows low expression as expected. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-FLOT1 antibody. Corresponding FLOT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA001393 |
|
|
|
|
|
HPA001393 |
|
|
HPA001393 |
Product Guarantee and Expert Support
