Anti-IMPDH2, Rabbit, Polyclonal
Catalog Number:
ATA-HPA001400
- Images (9)
| Article Name: | Anti-IMPDH2, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA001400 |
| Supplier Catalog Number: | HPA001400 |
| Alternative Catalog Number: | ATA-HPA001400-25,ATA-HPA001400-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | IMPDH2 |
| IMP (inosine 5-monophosphate) dehydrogenase 2 |
| Anti-IMPDH2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 3615 |
| UniProt: | P12268 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | IMPDH2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to cytosol & rods & rings. |
|
|
Immunohistochemical staining of human breast shows moderate cytoplasmic and nuclear positivity in glandular cells. |
|
|
Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1, using Anti-IMPDH2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Western blot analysis in human cell line U-251 MG. |
|
|
HPA001400 |
|
|
|
|
|
|
|
|
HPA001400 |
|
|
HPA001400 |
Product Guarantee and Expert Support
