Anti-PTPN6, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-PTPN6, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA001466
• Supplier Catalog Number: HPA001466
• Alternative Catalog Number: ATA-HPA001466-25,ATA-HPA001466-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human, Rat
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: HCP, HCPH, PTP-1C, SHP-1, SHP1, Pan-Cancer

Product Description

protein tyrosine phosphatase, non-receptor type 6

Additional Information

Anti-PTPN6

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 5777
• UniProt: P29350
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: HAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLK
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: PTPN6
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line A-431 shows localization to nucleus.

Immunohistochemistry analysis in human tonsil and skeletal muscle tissues using Anti-PTPN6 antibody. Corresponding PTPN6 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human tonsil shows high expression.

Immunohistochemical staining of human skeletal muscle shows low expression as expected.

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18
Lane 2: Human cell line RT-4

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

HPA001466

HPA001466

HPA001466