Anti-ZBTB16, Rabbit, Polyclonal
Catalog Number:
ATA-HPA001499
- Images (9)
| Article Name: | Anti-ZBTB16, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA001499 |
| Supplier Catalog Number: | HPA001499 |
| Alternative Catalog Number: | ATA-HPA001499-25,ATA-HPA001499-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PLZF, ZNF145 |
| zinc finger and BTB domain containing 16 |
| Anti-ZBTB16 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 7704 |
| UniProt: | Q05516 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ZBTB16 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human adrenal gland shows moderate to strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neuronal cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong positivity in nuclear membrane in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human kidney shows no positivity in cells in tubules as expected. |
|
|
Western blot analysis in human cell line HEL. |
|
|
HPA001499 |
|
|
|
|
|
HPA001499 |
|
|
HPA001499 |
Product Guarantee and Expert Support
