Anti-CA2, Rabbit, Polyclonal
Catalog Number:
ATA-HPA001550
- Images (9)
| Article Name: | Anti-CA2, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA001550 |
| Supplier Catalog Number: | HPA001550 |
| Alternative Catalog Number: | ATA-HPA001550-25,ATA-HPA001550-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CA-II, CAII, Car2 |
| carbonic anhydrase II |
| Anti-CA2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 760 |
| UniProt: | P00918 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CA2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human stomach and prostate tissues using Anti-CA2 antibody. Corresponding CA2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human stomach shows high expression. |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
Western blot analysis in human cell lines HEK293 and PC-3 using Anti-CA2 antibody. Corresponding CA2 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB. |
|
|
Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12. |
|
|
HPA001550 |
|
|
|
|
|
HPA001550 |
|
|
HPA001550 |
Product Guarantee and Expert Support
