Anti-ATF3, Rabbit, Polyclonal
Catalog Number:
ATA-HPA001562
- Images (9)
| Article Name: | Anti-ATF3, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA001562 |
| Supplier Catalog Number: | HPA001562 |
| Alternative Catalog Number: | ATA-HPA001562-25,ATA-HPA001562-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ATF3 |
| activating transcription factor 3 |
| Anti-ATF3 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 467 |
| UniProt: | P18847 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ATF3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli. |
|
|
Immunohistochemical staining of human urinary bladder shows moderate to strong nuclear positivity in epithelial cells. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong nuclear positivity in a subset of glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in myelopoietic cells as expected. |
|
|
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells. |
|
|
HPA001562 |
|
|
|
|
|
HPA001562 |
|
|
HPA001562 |
Product Guarantee and Expert Support
