Anti-FBLN1, Rabbit, Polyclonal

Catalog Number: ATA-HPA001612
Article Name: Anti-FBLN1, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA001612
Supplier Catalog Number: HPA001612
Alternative Catalog Number: ATA-HPA001612-25,ATA-HPA001612-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FBLN
fibulin 1
Anti-FBLN1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 2192
UniProt: P23142
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: CESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FBLN1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cervix, uterine and liver tissues using Anti-FBLN1 antibody. Corresponding FBLN1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human cervix, uterine shows high expression.
Western blot analysis in human plasma.
Western blot analysis in control (vector only transfected HEK293T lysate) and FBLN1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416606).
HPA001612
HPA001612
HPA001612