Anti-FBLN1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-FBLN1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA001613
• Supplier Catalog Number: HPA001613
• Alternative Catalog Number: ATA-HPA001613-25,ATA-HPA001613-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FBLN

Product Description

fibulin 1

Additional Information

Anti-FBLN1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 2192
• UniProt: P23142
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: NTLGSYLCSCSVGFRLSVDGRSCEDINECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLAFECPEN
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: FBLN1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Images

Immunohistochemistry analysis in human cervix, uterine and liver tissues using Anti-FBLN1 antibody. Corresponding FBLN1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human liver shows low expression as expected.

Immunohistochemical staining of human cervix, uterine shows high expression.

Western blot analysis in human cell lines HeLa and SK-MEL-30 using Anti-FBLN1 antibody. Corresponding FBLN1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

Western blot analysis in control (vector only transfected HEK293T lysate) and FBLN1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416606).

HPA001613

HPA001613

HPA001613