Anti-TOM1, Rabbit, Polyclonal
Catalog Number:
ATA-HPA001749
- Images (9)
| Article Name: | Anti-TOM1, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA001749 |
| Supplier Catalog Number: | HPA001749 |
| Alternative Catalog Number: | ATA-HPA001749-25,ATA-HPA001749-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | TOM1 |
| target of myb1 (chicken) |
| Anti-TOM1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 10043 |
| UniProt: | O60784 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TOM1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human endometrium shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons. |
|
|
Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17 Lane 2: Human cell line RT-4 Lane 3: Human cell line EFO-21 Lane 4: Human cell line A-431 Lane 5: Human liver tissue Lane 6: Human tonsil tissue |
|
|
HPA001749 |
|
|
|
|
|
HPA001749 |
|
|
HPA001749 |
Product Guarantee and Expert Support
