Anti-PTK2, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-PTK2, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA001842
• Supplier Catalog Number: HPA001842
• Alternative Catalog Number: ATA-HPA001842-25,ATA-HPA001842-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FADK, FAK, FAK1, PPP1R71

Product Description

protein tyrosine kinase 2

Additional Information

Anti-PTK2

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 5747
• UniProt: Q05397
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: PEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: PTK2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & focal adhesion sites.

Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Immunohistochemical staining of human testis shows moderate to cytoplasmic positivity in spermatogonia and Leydig cells.

Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in decidual cells.

Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic and membranous positivity in glandular cells.

HPA001842

HPA001842

HPA001842