Anti-LAMB2, Rabbit, Polyclonal
Catalog Number:
ATA-HPA001895
- Images (9)
| Article Name: | Anti-LAMB2, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA001895 |
| Supplier Catalog Number: | HPA001895 |
| Alternative Catalog Number: | ATA-HPA001895-25,ATA-HPA001895-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | LAMS |
| laminin, beta 2 (laminin S) |
| Anti-LAMB2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 3913 |
| UniProt: | P55268 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DLTDVQDENFNHALSGLERDRLALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHMANQRALGKLSAHTHTLSLTDINELVCGAPG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LAMB2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human heart muscle shows weak to moderate membranous positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human kidney shows weak to moderate membranous positivity in cells in glomeruli. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate membranous positivity in endothelial cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human cell line A-431 Lane 5: Human liver tissue Lane 6: Human tonsil tissue |
|
|
HPA001895 |
|
|
|
|
|
HPA001895 |
|
|
HPA001895 |
Product Guarantee and Expert Support
