Anti-SOX6, Rabbit, Polyclonal
Catalog Number:
ATA-HPA001923
- Images (9)
| Article Name: | Anti-SOX6, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA001923 |
| Supplier Catalog Number: | HPA001923 |
| Alternative Catalog Number: | ATA-HPA001923-25,ATA-HPA001923-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SOX6 |
| SRY (sex determining region Y)-box 6 |
| Anti-SOX6 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 55553 |
| UniProt: | P35712 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TYKPGDNYPVQFIPSTMAAAAASGLSPLQLQQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEAAAQPLNLSSRPKTAEPVKSPTS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SOX6 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human small intestine shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human glioma shows moderate to strong nuclear positivity in tumor cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts, as well as weak positivity in Leydig cells. |
|
|
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected. |
|
|
HPA001923 |
|
|
|
|
|
HPA001923 |
|
|
HPA001923 |
Product Guarantee and Expert Support
