Anti-ALDH1A1, Rabbit, Polyclonal
Catalog Number:
ATA-HPA002123
- Images (9)
| Article Name: | Anti-ALDH1A1, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA002123 |
| Supplier Catalog Number: | HPA002123 |
| Alternative Catalog Number: | ATA-HPA002123-25,ATA-HPA002123-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ALDH1, PUMB1, RALDH1 |
| aldehyde dehydrogenase 1 family, member A1 |
| Anti-ALDH1A1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 216 |
| UniProt: | P00352 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | IYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ALDH1A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A549 shows localization to cytosol. |
|
|
Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells. |
|
|
Western blot analysis in human cell lines A-549 and A-431 using Anti-ALDH1A1 antibody. Corresponding ALDH1A1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB. |
|
|
Western blot analysis in human cell line HepG2. |
|
|
HPA002123 |
|
|
|
|
|
|
|
|
HPA002123 |
|
|
HPA002123 |
Product Guarantee and Expert Support
