Anti-CD14, Rabbit, Polyclonal
Catalog Number:
ATA-HPA002127
- Images (11)
| Article Name: | Anti-CD14, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA002127 |
| Supplier Catalog Number: | HPA002127 |
| Alternative Catalog Number: | ATA-HPA002127-25,ATA-HPA002127-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Pan-Cancer |
| CD14 molecule |
| Anti-CD14 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 929 |
| UniProt: | P08571 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CD14 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human lymph node and pancreas tissues using HPA002127 antibody. Corresponding CD14 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver, lymph node, pancreas and rectum using Anti-CD14 antibody HPA002127 (A) shows similar protein distribution across tissues to independent antibody HPA001887 (B). |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human lymph node shows moderate to strong membranous positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human rectum shows moderate to strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human liver shows moderate to strong membranous positivity in hepatic sinusoid cells. |
|
|
Western blot analysis using Anti-CD14 antibody HPA002127 (A) shows similar pattern to independent antibody HPA001887 (B). |
|
|
HPA002127 |
|
|
|
|
|
HPA002127 |
|
|
HPA002127 |
Product Guarantee and Expert Support
