Anti-GOLIM4, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-GOLIM4, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA002315
• Supplier Catalog Number: HPA002315
• Alternative Catalog Number: ATA-HPA002315-25,ATA-HPA002315-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: GIMPC, GOLPH4, GPP130, P138

Product Description

golgi integral membrane protein 4

Additional Information

Anti-GOLIM4

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 27333
• UniProt: O00461
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: ENRQLRKAHQDIHTQLQDVKQQHKNLLSEHEQLVVTLEDHKSALAAAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQEVSRNNDVWQ
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: GOLIM4
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human small intestine and skin tissues using Anti-GOLIM4 antibody. Corresponding GOLIM4 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, liver, skin and small intestine using Anti-GOLIM4 antibody HPA002315 (A) shows similar protein distribution across tissues to independent antibody HPA001677 (B).

Immunohistochemical staining of human skin shows low expression as expected.

Immunohistochemical staining of human small intestine shows high expression.

Immunohistochemical staining of human cerebral cortex using Anti-GOLIM4 antibody HPA002315.

Immunohistochemical staining of human liver using Anti-GOLIM4 antibody HPA002315.

HPA002315

HPA002315

HPA002315