Anti-KRT19, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-KRT19, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA002465
• Supplier Catalog Number: HPA002465
• Alternative Catalog Number: ATA-HPA002465-25,ATA-HPA002465-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CK19, K19, K1CS, MGC15366, Pan-Cancer

Product Description

keratin 19

Additional Information

Anti-KRT19

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 3880
• UniProt: P08727
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: TEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: KRT19
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500

Images

Immunofluorescent staining of human cell line MCF7 shows localization to intermediate filaments.

Immunohistochemistry analysis in human urinary bladder and lymph node tissues using HPA002465 antibody. Corresponding KRT19 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human urinary bladder shows strong cytoplasmic/membranous positivity in urothelial cells.

Immunohistochemical staining of human small intestine shows moderate cytoplasmic/membranous positivity in glandular cells.

Immunohistochemical staining of human breast shows moderate cytoplasmic/membranous positivity in glandular cells.

Immunohistochemical staining of human lymph node shows no positivity as expected.

HPA002465

HPA002465

HPA002465