Anti-AURKA, Rabbit, Polyclonal
Catalog Number:
ATA-HPA002636
- Images (8)
| Article Name: | Anti-AURKA, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA002636 |
| Supplier Catalog Number: | HPA002636 |
| Alternative Catalog Number: | ATA-HPA002636-25,ATA-HPA002636-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | AIK, ARK1, AurA, BTAK, PPP1R47, STK15, STK6, STK7, Pan-Cancer |
| aurora kinase A |
| Anti-AURKA |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 6790 |
| UniProt: | O14965 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALEDFEIGRPLGKGKFGNVYL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | AURKA |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleus, cytosol & centrosome. |
|
|
Immunohistochemical staining of human testis shows moderate positivity in a subset of cells in seminiferous ducts. |
|
|
Western blot analysis in human cell line SK-BR-3. |
|
|
HPA002636 |
|
|
|
|
|
|
|
|
HPA002636 |
|
|
HPA002636 |
Product Guarantee and Expert Support
