Anti-SELP, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SELP, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA002655
• Supplier Catalog Number: HPA002655
• Alternative Catalog Number: ATA-HPA002655-25,ATA-HPA002655-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CD62, CD62P, GMP140, GRMP, PADGEM, PSEL, Pan-Cancer

Product Description

selectin P (granule membrane protein 140kDa, antigen CD62)

Additional Information

Anti-SELP

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 6403
• UniProt: P16109
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: EAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMT
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SELP
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunohistochemical staining of human bone marrow shows strong positivity in megakaryocytes.

Western blot analysis in control (vector only transfected HEK293T lysate) and SELP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418960).

HPA002655

HPA002655