Anti-LCN2, Rabbit, Polyclonal
Catalog Number:
ATA-HPA002695
- Images (8)
| Article Name: | Anti-LCN2, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA002695 |
| Supplier Catalog Number: | HPA002695 |
| Alternative Catalog Number: | ATA-HPA002695-25,ATA-HPA002695-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | 24p3, NGAL, Pan-Cancer |
| lipocalin 2 |
| Anti-LCN2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 3934 |
| UniProt: | P80188 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LCN2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using Anti-LCN2 antibody. Corresponding LCN2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human bone marrow shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Western blot analysis in Capan-2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-LCN2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
HPA002695 |
|
|
|
|
|
HPA002695 |
|
|
HPA002695 |
Product Guarantee and Expert Support
